PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 601aa    MW: 67461.7 Da    PI: 4.8665
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011959.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS283.65.8e-872285982374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl..fsevsPilkfshl 96 
                  ve Ll  Ae v  ++ e+a +lL+r   ++s++g+p++R++++f eAL++++ r++ +++ ++   +++ + + + ++  +++   +   P+ ++ ++
  Pbr011959.1 228 VEFLLVSAEKVGYQQYERAGNLLKRCDSRSSSTGNPVERVVHFFSEALREKIDRETGRVAPKVlGNKQSFNVDRAMKIPNDTTlaCQIKLPFGQVVQF 325
                  6789999***********************************************777776555344444434444444444443455668******** PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg.ppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  +  qaI+e v+++++vH+iD++i +G+QW  L+qaLasR +     l+iT+vg    + +e++eetg+rL +fA+++++pf f++++++++ dl+ ++
  Pbr011959.1 326 AGIQAIVENVAEAKKVHVIDLEIRNGVQWTGLMQALASRCDClLELLKITAVGT---TCRESVEETGKRLGSFAQTMNLPFCFKIVMVEDMLDLKEDM 420
                  ***************************************9652669********...69*************************************** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++++ +E+++V ++++l +++ ++  les     +k++k+++P + vv+e ea+hns+ F++rf++al y+++ fd+le+ + r++ +r+ +E +++g
  Pbr011959.1 421 FELDFEETVVVYSQFALRSMVPKPDRLES----AMKVIKNIRPCLTVVTEVEANHNSPVFVTRFIDALFYFAVYFDCLESCIQRDDPNRSILESMYFG 514
                  ********************977777777....***************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    i+n+va+eg+er+ r+ +   Wr+ + + G+++++ls++   qa+l+l++++ ++  +++ + ++l+lgWk+ pL s+S W+
  Pbr011959.1 515 TGIRNIVANEGEERNIRNVKIDVWRAFFARYGMEEIELSSSSLYQADLILKNFPyGNSCTLNMDGKCLLLGWKGTPLHSLSLWK 598
                  ******************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.544201577IPR005202Transcription factor GRAS
PfamPF035142.0E-84228598IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MTNAMFSFGD FNFGGVHDIF SSTEKGFDGM EAENNVGKQV NLFGAEEWGK LGEFGSVDSD  60
HGFYGNDYSS GGNLFPKYQQ EEQQQPLISY YGLYDAMQVD PLSMPFQACL GKIAKLEDIP  120
NLVPHVEPKK EKRDPFSSLA GLDLLNSYGS GFKRLNGERN FESSNYNACT DQVATGRKLS  180
TEEIMRVAGA RFIQTYSQVS DVPSMLSHPF GSSFSGLSYE EARDVELVEF LLVSAEKVGY  240
QQYERAGNLL KRCDSRSSST GNPVERVVHF FSEALREKID RETGRVAPKV LGNKQSFNVD  300
RAMKIPNDTT LACQIKLPFG QVVQFAGIQA IVENVAEAKK VHVIDLEIRN GVQWTGLMQA  360
LASRCDCLLE LLKITAVGTT CRESVEETGK RLGSFAQTMN LPFCFKIVMV EDMLDLKEDM  420
FELDFEETVV VYSQFALRSM VPKPDRLESA MKVIKNIRPC LTVVTEVEAN HNSPVFVTRF  480
IDALFYFAVY FDCLESCIQR DDPNRSILES MYFGTGIRNI VANEGEERNI RNVKIDVWRA  540
FFARYGMEEI ELSSSSLYQA DLILKNFPYG NSCTLNMDGK CLLLGWKGTP LHSLSLWKFL  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-372325988375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370004.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5XKD70.0M5XKD7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-57RGA-like 2